PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA33790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CO-like
Protein Properties Length: 424aa    MW: 47817 Da    PI: 5.4075
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA33790genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.11.6e-071962340
                   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                               +r C+ + + ++++fC  ++ +lC+ C    H+       H++v
  Tp57577_TGAC_v2_mRNA33790 19 ARACDSCLRRRARWFCAADDAFLCHGCDNLVHSAnqlasrHERV 62
                               578*****************************657788888876 PP

2CCT66.95.4e-23357400144
                        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk++
  Tp57577_TGAC_v2_mRNA33790 357 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT 400
                                9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.9E-91764IPR000315B-box-type zinc finger
PROSITE profilePS5011910.4091764IPR000315B-box-type zinc finger
PfamPF006433.2E-61962IPR000315B-box-type zinc finger
CDDcd000213.39E-82064No hitNo description
PfamPF062039.7E-18357399IPR010402CCT domain
PROSITE profilePS5101715.993357399IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MIKVMKSDAD AGALGAKTAR ACDSCLRRRA RWFCAADDAF LCHGCDNLVH SANQLASRHE  60
RVRLQTASAK VTTTAQAWHS GFTRKARTPR HNKNSSIQQQ QQRLKEKVLF NTSFLPLVPE  120
LGREEEEQGQ ELLVDIDEAE EENLLCRVPV FDVNPFDLEN CNVKNDGADF EEMCDLDSFC  180
EFDVDLAEFA ANVESLLGVG SNENIHENSS GQVFDYKQEN EIDASKNEVL KVKDEELDDL  240
ESVFDMTSDE VFHWNFDNNE SLAHHQEKEF VMVSNNSESV ISTKEETKRE RFLRLNYEEV  300
ISAWSRQGSP SPWTTGNPPK FNSDDDSWHN FLGSSGVEGE VRSLRGQLMG NNGDGGREAR  360
VSRYREKRRT RLFAKKIRYE VRKLNAEKRP RMKGRFVKRT SCFVGGVGVG GGGGATSLPT  420
NYH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1367383RRTRLFAKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1373110.0BT137311.1 Medicago truncatula clone JCVI-FLMt-21J5 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003630849.10.0zinc finger constans-like protein
TrEMBLG7L9P20.0G7L9P2_MEDTR; Uncharacterized protein
STRINGGLYMA05G35151.11e-144(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.12e-84B-box type zinc finger protein with CCT domain